DPCstruct | MC10111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534ZRR5 | 2-103 | NTAECARRLSDMVKDFEDLDTKHNLVVDCERRGDQLTTEILQRLDSTFVTPFDREDIHALAEELDDVVDDMLAVSDLLRLLSIEAIL… |
| A0A538S470 | 1-125 | MAFRLLPREEKFFDLFDETAAVISRAAGKFLDMVTSFDRLAARANEIKLEERMCDEMIARIIKALDRTFITPFDREDIHTLATKLDD… |
| A0A847J860 | 8-128 | None |
| X1LCK1 | 1-107 | None |
| A0A7E4SEU6 | 281-411 | None |
| A0A534SB74 | 1-123 | None |
| A0A087ARU9 | 350-472 | None |
| A0A7V3VXF8 | 94-220 | None |
| A0A533VGE7 | 13-132 | None |
| A0A5E4NRU1 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.