DPCstruct | MC10110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3U6L4 | 272-376 | DQYRERLQERSWDNLYILNEWRRLYGDVDALALHEDIWGTRLTCPGGGEYVWNDHLSSYESTVYGHPLEPLPGPGLRELLGHIEAGN… |
| A0A538S3U7 | 15-144 | APNGWEESVEALRYYLEWESQRRALPNCTAWYALDHCGLIATDAPEKTRQAAALRYLGFVPVSPDGAAYGYDPRTDEVVNRRHGSPR… |
| A0A5C6DQE7 | 236-358 | None |
| A0A1E4HNU9 | 5-111 | None |
| A0A1V5GFI8 | 11-124 | None |
| A0A7X7FIX0 | 62-193 | None |
| A0A7C8D622 | 111-238 | None |
| A0A7Y4WJC7 | 583-705 | None |
| A0A7X7QJB5 | 105-237 | None |
| A0A7C8EI71 | 947-1068 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.