DPCstruct | MC10109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 32 aa |
| Standard deviation of domain lengths | 32.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8NNS0 | 2-111 | TLSKLNQFENGTLFETEQEMLYVLQLNGSWYEMGRQYGALSKEPMQAMYDKIVQPEFDNGLISQEEAFELFGRRVFKSLSLRRKQYF… |
| A0A538RZW3 | 1-152 | MFPSRYAYAVLPVLLLVSSAARGEEAFRYALGKHGKGELKYVNGLPVLTVQGTPEEIGEQTGVLMRHAAPGLVGYFKKLLKTYRAEA… |
| A0A482SEJ4 | 1-215 | None |
| A0A0W8EBD2 | 6-138 | None |
| A0A3R7AN91 | 41-198 | None |
| A0A7V4JSD4 | 15-209 | None |
| A0A354ZC99 | 3-170 | None |
| A0A814Q8N1 | 25-221 | None |
| J0WNI3 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.