DPCstruct | MC10108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2DHR3 | 214-313 | VSTSSASSSKDRERPVWDKTARALRFGDFVCKRFKRPAPSQEVLLDVFQEEGWPDAIDNPFPPSKGTRKLDNAIDSLNNRLEHIRFH… |
| A0A517TGH4 | 166-256 | HDGIKPEWDAASGKLFYNGVLVREVSAGATNLRRILDSFQELGWPSRIDDPLPGGPNPERLKNACKKFRDGAEMLEIRPDGTGKGSL… |
| A0A1P8WGW9 | 197-304 | None |
| X0RKG1 | 62-153 | None |
| M5RCZ0 | 110-244 | None |
| D2R1G9 | 235-358 | None |
| A0A5Q4GJX9 | 78-176 | None |
| A0A518GZV2 | 120-218 | None |
| A0A3E0N6X8 | 95-205 | None |
| A0A3L7QRL9 | 110-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.