DPCstruct | MC10105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 373 ± 64 aa |
| Standard deviation of domain lengths | 63.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 64.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 16.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2VWK9 | 4-358 | VTERIKSLTNNYKITKKENLPAFVEICKQLKYTSSQADSIRLMRMECTKVLNSTVKKNILRDFLTMDGLSILSEWITNCSDHVDETM… |
| A0A4P9Z1U2 | 4-422 | QQEANWSRENSPAAMSAEPGSSAAGLDDRKRKSDAGAHPMTPATKKAHTGTTPDMPPRQIPIHSQMRQFLAPNGGLAYSADMDSFRK… |
| A0A397ER87 | 51-447 | None |
| A0A3Q0KED8 | 11-323 | None |
| A0A7S0PQG3 | 185-637 | None |
| A0A817T3X7 | 1-338 | None |
| A0A1Y2BYY7 | 2-423 | None |
| A0A150GHS7 | 1-357 | None |
| A0A0L0HNL7 | 428-933 | None |
| A0A7S3H063 | 83-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.