DPCstruct | MC10104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IFJ0 | 80-160 | EEALGLIARYARRSATPVSLRQLLEFGRRPTPKKLLLAAQLMHRELAIRLAHRVVELQALPYGLSAMRSVRRVRELYENSF |
| A0A4P9Z1K5 | 3-91 | RIPPSLYEKIKYFATFPQTGVSLRQMVKFGQQSSPGTLFRAGQFVAGKSCLPIRLAHRVVELENLPNHLSEMPSVVKVKHWYAQSFK… |
| A0A1C7LM48 | 1-90 | None |
| A0A445MK45 | 1-63 | None |
| A0A7J6DYG4 | 9-89 | None |
| A0A427YKR0 | 9-81 | None |
| A0A426Z1F0 | 50-168 | None |
| A0A287HGW9 | 93-173 | None |
| A0A821PMY2 | 1-107 | None |
| A0A1Z9KW00 | 35-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.