DPCstruct | MC10103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 241 ± 30 aa |
| Standard deviation of domain lengths | 30.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LUC2 | 3-228 | STKETRQVLPEASEAPKPVREEDAALQELEDSKDTPGFEIGDDIVENASTHASGDEEGEESSETEDDYDSDDSDDEYTRNRIGKVPL… |
| A0A4P9YYY2 | 90-328 | VGIDMKSDEEIEAGDGGDNGDSDDELPEVDPASDSEVAADSDDETDSEAGFYEGSEDDDDDEEEAEEDAEPGLDPALNPLRGTIWPE… |
| A0A834F0H6 | 42-286 | None |
| A0A2P2KXG9 | 1-235 | None |
| A0A2C6KNI0 | 231-467 | None |
| A0A7R9MNW2 | 18-265 | None |
| A0A6A6KXX5 | 5-247 | None |
| A0A2G8L247 | 2-293 | None |
| A0A835EEA0 | 2-206 | None |
| A0A482RXX8 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.