DPCstruct | MC10102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 121 ± 22 aa |
| Standard deviation of domain lengths | 22.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835S3R6 | 22-141 | EDLKYMAGFGNHFSSEALVGSLPEGQNNPLLCPMGLYAEQISGTAFTVPRRSNQRSWFYRIRPSVTHEPFQARKPHHSNLLGEFNQE… |
| A0A4P9YXL8 | 1-102 | MSSSNNNGEQRTFNYMPGFGNTFSSEALPHALPKGQNTPQVCPYGLYAEQLSGTAFTVARHGNQRRMAHTHAIITRAYLPPPPPPTA… |
| Q5BG53 | 24-157 | None |
| A0A7R9NWT7 | 71-172 | None |
| A0A0A9EKC6 | 6-109 | None |
| A0A6S6VQC0 | 35-169 | None |
| A0A2H2JAP1 | 1-141 | None |
| A0A661NP96 | 569-680 | None |
| A0A6A2YHC0 | 1-95 | None |
| B7P9L8 | 38-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.