DPCstruct | MC10101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 236 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UJY5 | 2-200 | SSNSSIVPTVDSYLSTICSSDPCTNTTLTSVADSIIQGCASDLTKFGVDNQTVRDMIDLYPLAREVVCLKTEDPESLNNATIPLDST… |
| A0A4P9YX16 | 5-210 | DDNELARCLPVHSLMSLAGDALPEPDEFSATVKGVCRFPPCRDSLVRGLQADLRAQCSSNIQSGEYAQTFRTALYILDNYAPLRNAT… |
| A0A0F7SRU8 | 15-252 | None |
| A0A397UYP5 | 47-275 | None |
| A0A2S4WJH6 | 43-316 | None |
| M7X0L5 | 703-916 | None |
| M9LWH9 | 206-468 | None |
| A0A166I7K7 | 24-228 | None |
| A0A409XSL2 | 7-236 | None |
| A0A146I8J2 | 13-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.