DPCstruct | MC1010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M8SXM1 | 2-115 | QKIIDVAVKELISIIDSKKHSKKVAMQFVLEELDAARQGNDYVKDKIKSFYFNESDYIGAMESSWEDVDGPTGPQQFLVVLTMQLSK… |
| A0A6P1KFG3 | 1-131 | MFNIFNKKPCNDPELLKRIQEDGIDYAALRFSQILIRDYLTRRIDAYNFILQELDGARQGNEQAKNFALESGIDSKEYIGTLKLDTP… |
| A0A7I6ZH59 | 122-242 | None |
| A0A4U1Y7K6 | 1-129 | None |
| L8XX56 | 4-115 | None |
| J0LBX1 | 28-147 | None |
| A0A1I0IHJ3 | 2-115 | None |
| A0A836WZR4 | 4-120 | None |
| A0A1Z5HED0 | 61-192 | None |
| K6YCE0 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.