DPCstruct | MC101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5V3WRE3 | 3-87 | ALSKAQKEVLERKIARWVWQKQRPVTAAEIARKFSVGIHLARCLIQRIMRRADGIRCTLETAPGKNSAGNTGIVKYFSVQHLPES |
| A0A7W4F5S5 | 1-116 | MKLQHDESITLPETVAHLAEQPLCRIVATWGLLQNHYLNRQRIMQAFNVPRRKAGYILRYIVHSPCITCDQHVYTHPRSHRQELRVW… |
| A0A7I8ZCA5 | 20-151 | None |
| A0A7U9H4Y1 | 3-124 | None |
| A0A746B3E5 | 1-113 | None |
| A0A376DJL7 | 17-133 | None |
| A0A756I668 | 45-170 | None |
| A0A509BKG6 | 27-123 | None |
| A0A161IAM4 | 2-117 | None |
| A0A7W3B5C3 | 4-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.