DPCstruct | MC10099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2NTC7 | 4-92 | LPREDRKLRLMLGQTRIVQVTGKTALAALDGCDGADILIANMPDPTPRPCLRFDARALRKTGALALWSGPEGPRIETVAERAGRRLW… |
| A0A7Y1T5Q3 | 5-129 | AGDFIRDILSENAGYDGDPGPLEEQAFANCNRDACLAAIEGDERSFTLLAVRSRDYIAWKELTDACASVDIVVAERWMPRGCTPRWL… |
| A0A2P7BSB0 | 6-106 | None |
| M4ZT81 | 230-327 | None |
| A0A6M1SCS1 | 6-134 | None |
| A0A3A3HWV9 | 61-161 | None |
| A0A1D2ST88 | 176-310 | None |
| A0A4Q1TTB9 | 862-981 | None |
| A0A1D8QTQ0 | 13-121 | None |
| A0A225X7T3 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.