DPCstruct | MC10098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 17.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0511- PF13352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YPY2 | 41-134 | VPPISPNSSQACPPRRPIVCFGCGVTGHGLDSCNAINDLVKKGLLARDDNHQVIYPNGQCIYRNGDEMILQAYERSVNATQPTNTVH… |
| K5XZK2 | 2-138 | QAYMDSMRSNLTASIAKLGSHSGPTHQRAPQNQYSYQSGSTSGPNCFYCDEPGHRWVVCPHKAQDEKDGKIVQDGSKLRFADGSGIP… |
| A8ND60 | 23-143 | None |
| A0A4Y9XV54 | 243-366 | None |
| A0A2S4W0X0 | 52-192 | None |
| A0A146HKW4 | 1-141 | None |
| A0A5B0QRS8 | 271-389 | None |
| A0A0D2P1Q5 | 121-232 | None |
| A0A0C9YDH9 | 25-156 | None |
| A0A0C3JS83 | 80-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.