DPCstruct | MC10096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 34.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256WDD5 | 304-515 | DLEIGNDTQIDGNYYFVGDLIIQSGATVEWGNGYCLMEEDSKIIIEPGAKLTLNGTTCIGTCGQTWLGIELWGNPDEHQFTIDGECA… |
| A0A1F3D830 | 24-204 | IDTAICPPYEAKSINCSNTSPAFVNRYNDETMNQNLVIKPGKTLIIKSTVKFQKDCKIVVEPGAKLILDGCRLTNSDCGNNMWKGIE… |
| A0A256WCC1 | 228-417 | None |
| A0A7K3WVA1 | 92-336 | None |
| A0A521W2G9 | 298-468 | None |
| A0A1V5VD09 | 899-1056 | None |
| A0A2P7TMA6 | 254-527 | None |
| A0A7Y7A968 | 447-649 | None |
| A0A7X8HSQ3 | 387-585 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.