DPCstruct | MC10094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0EA05 | 15-118 | IENPLCVFKKCDDSIVVLRKLEDTVTDELRSNIVQRNFATFRANKLYVEKIIDIETLEDVIEVINTIYPHKHLTYIEGKVIEEKHFH… |
| A0A1Y4U2P0 | 52-164 | TLFYFPACPCEGSFIGYKKAVTESGYAIVRRYIPEDAKRNSATSYRCRADRARVLEITDETGRALEEARSGRDESFVYRRGQWLEVR… |
| A0A0A2FD23 | 133-231 | None |
| J5WNH5 | 15-106 | None |
| A0A497BG81 | 164-258 | None |
| A0A1M6XJC7 | 139-233 | None |
| A0A0G0PPA1 | 14-122 | None |
| A0A7C1PQ96 | 83-190 | None |
| A0A1A3GY81 | 103-215 | None |
| A0A6C0EA14 | 655-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.