DPCstruct | MC10092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 16.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838B373 | 4-165 | LKEFLEALAVAWPVALTALIGCVALLAGNAYGVRYASGIPEWVLTVIFAVAVFAAGICIVFTLQSIGRGFRRLGKWNRTRKYRKAQI… |
| A0A374LBW9 | 12-178 | GSMSVIKTIIEKMKLKEICAVLFIAGIIITYMPQDYAMKFSIVEFRETYQTYISVGLIIIAAFYIFSFITWVSEKIFFKFHNPEKIG… |
| A0A0M4DKU3 | 42-222 | None |
| A0A484HNI9 | 7-163 | None |
| A0A370Q333 | 30-204 | None |
| A0A137PLV0 | 3-198 | None |
| A0A1E3X2X7 | 1-151 | None |
| A0A6G1N287 | 4-157 | None |
| A0A1T4VWX1 | 1-174 | None |
| A0P353 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.