DPCstruct | MC10090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 236 ± 30 aa |
| Standard deviation of domain lengths | 29.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2I6F6 | 195-448 | IDGIYESQIPSDFRVMCQLGSVVRPDHGVGLGGQLTLNSFRPIQNDKLTYLPQPLRTIFLYKFSQDSRHVYSLIDTSGSAAYFYVVN… |
| A0A7R8ZZ02 | 6-211 | NQADTTSFDLKHLQFVSLAQHGYLETNALRSSYLYQHTVGNKSLLALIFPAQKKGHFFAVDTVRTNQMPNLKNMYTTERNAALSRAS… |
| A0A7N2KRE7 | 387-599 | None |
| A0A820TFL3 | 534-805 | None |
| A0A4C1UE30 | 1-215 | None |
| A0A4Z2E0Q1 | 13-219 | None |
| A0A817MBE2 | 4-273 | None |
| A0A6P5RP69 | 3-210 | None |
| A0A452YAU9 | 479-731 | None |
| A0A7N4NHU2 | 866-1073 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.