DPCstruct | MC1009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1U3P6 | 1-111 | MPAASISLTGVPAGWTPYIDSPLYLSAAAPIDGAPQRRGQLVPSGERKKKGKTTLSYRLEGRYPDGKWLQCSYGVHGEVTLSRRMDD… |
| A0A7S7C288 | 1-145 | MKLLWALALVGTCTPVAAKETLQCPDTLRVSDAVLQSPDLPAGTSIDLERNGSLRLFSMGVYSGHPRDMAQLIPSNEGEPKPRGRSI… |
| A0A2V9ZFN6 | 29-155 | None |
| T1W5P2 | 15-136 | None |
| F0Q084 | 37-176 | None |
| A0A4Y9SVV5 | 1-137 | None |
| A0A2G8TJ94 | 11-129 | None |
| A0A0U3LTK3 | 11-130 | None |
| A0A7U2L4W6 | 55-200 | None |
| A0A4R3M3C5 | 6-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.