DPCstruct | MC10087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821K125 | 175-306 | CVRIIHKETHEAVANAAKNLLKSLSYVYPTEYRLTVENIEEPFTDFLPIRAWGQHVEFEKLQVQFHIPNGEEVDFACEFVETFIFPE… |
| A0A7R8ZR81 | 7-146 | SQETLSLIFFFLSNFYTVESRMRAEGNDSPISECLHIRLWGKPVGADQLKLRWYVPTSRHAEIISRLLEKFILPEIVTLQAVARKEI… |
| A0A0R3Q878 | 19-147 | None |
| A0A819N5H1 | 108-236 | None |
| A0A820KBW2 | 8-130 | None |
| A0A820AE08 | 523-646 | None |
| A0A820SVQ1 | 15-148 | None |
| A0A0M3IUZ5 | 4-125 | None |
| A0A821FZJ2 | 103-234 | None |
| J9EQC4 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.