DPCstruct | MC10086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 126 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 99.04 |
| Assigned Pfam label(s) | PF07542- CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T3G5 | 1-113 | APPKRFYKNTGVISSNGRYEITLDSRKLKTPRGLPFYVESEPLAIAIATEWDAQKEVIDRSSMHLTALSSTVIDNPNSLQKHDMVNY… |
| A0A7R8ZNQ3 | 13-144 | VSVQMDSTERKRWYKEVRVASSHEHVESMGQSSKSFGIEINLDQKKLRTPNGKLLLLPNPILAAAVAEEWQCQGEKIRRSEMHLTSL… |
| A0A6P5UCB2 | 118-237 | None |
| A0A6M1SQM5 | 18-140 | None |
| J3PDY0 | 145-295 | None |
| B9FUH3 | 45-209 | None |
| A0A183WML3 | 1-91 | None |
| A0A146H6K5 | 20-165 | None |
| A0A162VA95 | 216-368 | None |
| L8HF53 | 70-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.