DPCstruct | MC10084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368G5Y5 | 43-152 | IGKERALDQQIPSSYIAMLKVVRELHTELRRDAVSAIMTLEQFRERTKQRMSQKFGRPFRDDIEFRGACSFLHDSGEIVHFEDASLR… |
| A0A7R8X0E6 | 1-96 | MLEEIVGILVQERRNQGLDPVLTSEEYRTSVAQEMSTRYGRSFRDAAELNQATSFLHENGVLLHYEDATLKELYFLDPQWLCDTLAH… |
| A0A2T7NFH5 | 281-372 | None |
| A0A814XRV0 | 801-909 | None |
| A0A402EB49 | 2-113 | None |
| A0A1X7V3Q6 | 1-97 | None |
| A0A2G5VN11 | 869-973 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.