DPCstruct | MC10083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 99 ± 16 aa |
| Standard deviation of domain lengths | 15.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F2J6P8 | 4-101 | TKPFTHEDCIETGYAMSIEGKVIVIALSALSEQYHNRENQLYYCDGGNGSRPNPMGRSIFAASLYDGVKMRWNRSDVVGVLKPELLP… |
| A0A3E3DGC0 | 18-112 | ELLSEKDCIEESQKGNIENQLVVLSYKSLKPEYRLPRNQIWYVSHGPGCNPDSKFSDTVHLYHPMDRDRMAVSRREILGVVKPEVLK… |
| A0A316MBG4 | 42-165 | None |
| A0A096CHY0 | 10-127 | None |
| G4KY10 | 137-237 | None |
| A0A7X5HZ86 | 129-234 | None |
| A0A3D2N344 | 108-227 | None |
| A0A1Y3ZS70 | 134-234 | None |
| A0A1D8GCX3 | 1-111 | None |
| A0A0F9EXU4 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.