DPCstruct | MC10082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1SRJ7 | 20-117 | TDPAEEAAIQYLLSQVEQSPCQFVRNGKAYDGEDARAHIERKYRYILGKGHTLDAEAFIEHAASESSFTGRDYQIQCPQQPVEPSAD… |
| A0A2G3K5P7 | 4-96 | NATREINHLLDFSARSGCQFVRNGTVYGAKEATDHLRMKLGKVGERVKTADDFIEHIASQSYLSGTPYSVRCPGANEQATKAWLSTE… |
| A0A2H0LM12 | 67-177 | None |
| A0A377A7I7 | 21-118 | None |
| T0R9C0 | 10-108 | None |
| A0A420EL26 | 16-101 | None |
| A0A0H3U7B2 | 282-378 | None |
| A0A2A2IVN5 | 2-87 | None |
| A0A848A399 | 25-135 | None |
| A0A3D3GLR9 | 99-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.