DPCstruct | MC10080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3JYG0 | 8-89 | CDYMKMVIESPDMPIVFTAKYREFGLQIMDGGSSCIRLGFCPWCGQKFPTSLRDAWFDELEKREIDPYAENIPAEFSDHRWY |
| A0A553AC96 | 9-91 | KLNSSIDFENVDTPIVYSEKFDEYGVKIWDGGTSSISIEFCPWCGQKLPNSKRDQWFDEIEKLGIDPWNGKIPEKYLSDKWYR |
| A0A397FKD6 | 30-120 | None |
| A0A1G8E9H9 | 207-305 | None |
| A0A6I6LG50 | 6-78 | None |
| A0A7J0BWE7 | 5-83 | None |
| G1XVK1 | 9-83 | None |
| A0A7Y0E210 | 1-61 | None |
| A0A5E5PM67 | 1-64 | None |
| A0A1H1DUG1 | 55-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.