DPCstruct | MC1008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11275 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9GEU7 | 14-100 | GAVCMPVTVELSFTICNPDQEHLLAVRPGIPVTDALEEASCILSELKSSLEAAAMGMDGITPNQAWLLFRAVGTAKAIVDSTHAGLE |
| A0A1H5B4Y1 | 2-87 | TPSIVINTVGGATFAKCNAQNQPLFRINAGISCEEALEQASLLMDCVNKLTFLSGMENDNASMVWASHYLSEMAKAIIDDVTSGLQ |
| A0A4R5SM43 | 3-88 | None |
| A0A7D6E9H7 | 43-131 | None |
| A0A1F1PW89 | 1-87 | None |
| A0A2S4J7W3 | 10-97 | None |
| Q4KHZ0 | 69-161 | None |
| A0A2V5AH18 | 1-77 | None |
| I4N890 | 4-82 | None |
| I4N6H3 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.