DPCstruct | MC10079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9E095 | 4-85 | TEVYVIVEGQTEQIFIREILAPLMSYKGIYLHPAIIGKPGHKGGDIRFERAKSDIGKLLKQRYSIYVSTMFDYFRIEPDWPG |
| A0A2G3JY05 | 1-71 | MTEIIVFAEGPSDEQFIKQVVAPALRHLQLYLKPQTLQTSQHISGGAVSFDRLKFNARNTLRQNQNIVLTD |
| A0A5B8XS94 | 2-86 | None |
| A0A7W9M564 | 6-94 | None |
| A0A3M1L0E2 | 1-94 | None |
| A0A0M2PYZ8 | 1-93 | None |
| A0A2R5FFC0 | 1-93 | None |
| A0A833H3M5 | 2-94 | None |
| A0A5J4QTQ9 | 2-84 | None |
| A0A1Q3PQB7 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.