DPCstruct | MC10076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2FTN7 | 1-77 | QMSAADRQQMIAGMVDRLAARLNGNGDDLDGWLRLINARMVLGQKDKASEALNSAREQFKANKDALAQLDVVSRRHN |
| A0A7S8C249 | 1-93 | MPQPDGEAAKAIMEADPEARQAMIEGMVDRLARRLEENGDDLEGWLRLARARSVLGDREAAADALDRAAERFAGDETASARIESMRA… |
| A0A2W2AVK8 | 327-418 | None |
| A0A1E2RX57 | 288-380 | None |
| A0A4R3TPT8 | 81-172 | None |
| A0A0N1LAA5 | 19-108 | None |
| A0A258D2N0 | 46-130 | None |
| A0A4Q0RWK0 | 154-231 | None |
| A0A5J4DZZ0 | 196-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.