DPCstruct | MC10075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4CX86 | 1-61 | MATLDEGRTVVTLTEDKGVQRCAIYPEALLDHSCNVAGRNLTQAEWSTALPDLPYAQTCPG |
| A0A2W2GUD8 | 10-90 | IAVLEAHTDRVTSVAFGPDGRTILTGGDDDVARRWGYPEQWPDRPGVDAAEAWLCRVVTTPIGTARWHAYFPGVPYRPPCP |
| A0A243Q4V4 | 104-170 | None |
| A4YQ52 | 46-115 | None |
| A0A1V3WB54 | 178-263 | None |
| A0A0B8N0X5 | 1-70 | None |
| I9KJF8 | 130-188 | None |
| A0A7V3X130 | 1-77 | None |
| A0A7K2J761 | 39-108 | None |
| A0A510CW50 | 6-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.