DPCstruct | MC10071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660USI0 | 60-196 | VPTKPRTPGYWKHQFGGKGKHKETDPQLTGYLNDTKNRSGVFAGLTGNVDADRDAVLVTLKPDDSSIMLDKAKKHLLAMWLNIASGK… |
| A0A2W2F368 | 4-136 | RGKARTALTAAAWAAETRKGDGKVTDATLACYLSLVKRASKVFPEVAKMATRSSAGKVLRFTTAKAGGAALDRELLAAWLNWAHGAR… |
| A0A6N7FUQ0 | 767-904 | None |
| A0A7J2TMF5 | 164-294 | None |
| A0A523WCB7 | 566-702 | None |
| A0A6N7G8I4 | 911-1045 | None |
| A0A1W9T1W1 | 188-327 | None |
| A0A1I6KMQ9 | 947-1082 | None |
| A0A656TKW8 | 3-120 | None |
| A0A177Q3Q2 | 52-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.