DPCstruct | MC10069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 199 ± 32 aa |
| Standard deviation of domain lengths | 31.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF20318- PF07963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6R934 | 80-267 | VALGIVGVVSALVIPGVYIGIREQQYKTSLKKAYKDLTQVTMLIKQKNKNTLSGVFTSPTSLRDEYLSYMNYLKICDPAATQGECWY… |
| R5K744 | 2-189 | IANHRKQEYTARLKKGYTVINSGFQQLILNNGCEGNFDALRCTGLFGDDDSYKAENPQWVENIDREIRKVFNVTKTCKVNDTSCAIQ… |
| R5H2U3 | 2-206 | None |
| R7MAE7 | 25-203 | None |
| R7MB65 | 8-201 | None |
| R7JA47 | 15-237 | None |
| A0A292RAD4 | 1-205 | None |
| A0A292RC94 | 83-305 | None |
| A0A3D0SI26 | 2-175 | None |
| R5DIB4 | 43-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.