DPCstruct | MC10068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 198 ± 36 aa |
| Standard deviation of domain lengths | 36.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0722- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377DIT3 | 2-165 | NYEISSRVAYETAHYCLLDTLGCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWG… |
| E2XSF8 | 3-182 | LYSFVQNFSYKDAPLHTRELIKTCLLDIIGVAAGARNNQTSVMLKTYADTHYSANKLSSRLWFDGRAVHPLGAAYAGGFCVDSLDAH… |
| A0A507BJE2 | 785-988 | None |
| A0A5N0UQJ6 | 3-198 | None |
| A0A0C9TTA1 | 94-258 | None |
| A0A661QQI5 | 3-142 | None |
| D8K688 | 1-120 | None |
| A0A5N6EWI5 | 173-376 | None |
| A0A171JUW9 | 1-145 | None |
| A0A7K0IFB0 | 51-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.