DPCstruct | MC10063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A424QLI1 | 3-63 | TRRIVSYEKLDQSIRKLIKSDYPDGFEGRTFNLRLPTSKDVFKMIRFEAEGIQYMIKLGPA |
| A0A7Y2BYY2 | 1-61 | MSKPKVLKDYDKLDEQILEQIKLNYPYGFEKHLILFKGPKKNLISALPFETEDRYYLVRMT |
| A0A132HVV4 | 9-78 | None |
| A0A090Q385 | 1-70 | None |
| A0A060RBL2 | 13-78 | None |
| A0A7V4JLX9 | 157-221 | None |
| A0A4Q0XF80 | 8-75 | None |
| K1YF10 | 34-102 | None |
| A0A143XNH3 | 9-70 | None |
| B0MST6 | 60-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.