DPCstruct | MC10062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 214 ± 19 aa |
| Standard deviation of domain lengths | 18.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7AHQ8 | 16-222 | RPAEPLLTDLLSRPQAQGLSTLVLIDEVLMYAREKVSMGAVWRGRLIDFFQYLCQAVTKVDRCAMVASLLASDPDKNDSFGKELIGQ… |
| A0A7V8VRS2 | 7-231 | GAKGYAYVANADLKGVSPGSETLRELFSEAAPCLILIDEWVAYLRNMYKVEGLPSGSFESNLTFAQALTEAARLAPDTLVVASIPAS… |
| A0A7C2BZA2 | 162-354 | None |
| A0A3L7T3B2 | 325-542 | None |
| A0A848A8E1 | 329-569 | None |
| A0A7C1J700 | 316-515 | None |
| A0A2G9ZVB2 | 3-211 | None |
| A0A7K3LJH2 | 75-311 | None |
| A0A140K9V6 | 1-184 | None |
| A0A2N8LF45 | 332-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.