DPCstruct | MC10061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 204 ± 36 aa |
| Standard deviation of domain lengths | 35.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0YF34 | 2-207 | AALSRELPVAIKRLQAENIAPVDLAQAAIGPGMEVFSRYARVLEADGAPMSVRQALVEINRVLDGTLAEGEGYMDADTRFCVAWFEQ… |
| A0A357B6K7 | 2-170 | KRFWSYGFRGADLIVACYSPAVGVFGKYERVEKADGTPVGIPELLELAKQAARDAIAGEFRGDNLSTLYYVWANLYGVSEQTWDDAR… |
| A0A011NP66 | 457-658 | None |
| A0A7X4DVW4 | 2-175 | None |
| A0A1I6EHL9 | 348-552 | None |
| A0A1V1PCQ7 | 87-359 | None |
| A0A257U643 | 24-296 | None |
| A0A661LC53 | 34-279 | None |
| A0A7K2E826 | 6-177 | None |
| A0A6B0XVM3 | 2-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.