DPCstruct | MC10060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 25.00 |
| Assigned Pfam label(s) | PF20872- PF16296- PF14785 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5QSR8 | 16-150 | KWSVIGLLGLLVGYLVVLMYVQGEYLFAIMTLILSSAGLYIFANRKTYAWRYVYPGLAGMGLFVLFPLVCTIAIAFTNYSSTNQLTF… |
| A0A351JWB1 | 8-145 | AAVLKILVLGGLDALAIWGGIILVGDARFLLAALLLVGVLGINFLFLSRRAYPLRYILPGLVFFLAMTVYPFAYTVRIAFTNFGTGH… |
| D0LWJ2 | 4-130 | None |
| A0A2T3MS01 | 1-149 | None |
| A0A378N8H3 | 3-134 | None |
| T0QJW8 | 1-141 | None |
| A0A8A5VYL2 | 1-153 | None |
| A0A448QM02 | 14-136 | None |
| W4UHU6 | 23-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.