DPCstruct | MC1006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C1DFU8 | 4-86 | LGDLGADSQPFIGTMEKSAGYGKIVGRKTADNKARWRLDYDPEKGLHINVEDFRNGKKEQAIKYAIPIEGDEETFKSLLKHLN |
| A0A2T2XWW0 | 165-270 | NNRIETVLKPEKNWESARNKALDIVGNLGDDSKPVIGRLEVSAGNGKVIGRQSSDGKLGWRVDYDPEKGTHINIWDYSQGKGPGKAV… |
| A0A7W1XU95 | 306-409 | None |
| A0A1F3SWM8 | 63-187 | None |
| A0A6G0ZVM7 | 9-105 | None |
| I1D6G3 | 81-178 | None |
| A0A2A9NG23 | 126-243 | None |
| A0A838EZ84 | 51-167 | None |
| A0A518V7L0 | 36-137 | None |
| A0A821W530 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.