DPCstruct | MC10059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 158 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5UW33 | 30-181 | AKATLRKAKYLEPIPAALAYLKSSQLPGKKLARFYELHTNRPLYFTNDYQLTYDAADVPTHYSFTVDSRVDALAEEYQRYRPRTLDR… |
| A0A550GNB1 | 293-448 | LLELFLTTGNETYLEPIPAAIDWLNSSTIGDNLWARFYELGTNLPIYCDRERKLTYNLSELGEERREGYGWQGSYGTSGISMYQEVM… |
| A0A7C7R2E4 | 550-714 | None |
| A0A3A8I342 | 114-274 | None |
| A0A2E8CXU3 | 289-451 | None |
| A0A7C8DC90 | 126-287 | None |
| A0A517RBE3 | 387-541 | None |
| A0A3C1AYJ9 | 67-221 | None |
| A0A350EPN7 | 327-500 | None |
| A0A7C6XEQ6 | 2-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.