DPCstruct | MC10056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 160 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858REV3 | 3-159 | AELQRYINDHLAGASGAIDLIRSLVETSEEPEESHFFRELEIKVERDRDLLKGLLEKMGRSSSTLLEIAGNLSSKAGRLKLMWEGLK… |
| A0A2V6KM23 | 31-207 | AFAERNLSISIVELAMKALASYLNDHLAGSVAAIELLDHLIKEQSGQRLEKFLVDLRDDIRIDQEVLQNLIGKLDLEESSMRKVSAW… |
| A0A5C4VET7 | 7-168 | None |
| A0A4V6AWV5 | 1-154 | None |
| A0A1I5I884 | 60-214 | None |
| A0A2S8GRF7 | 147-304 | None |
| A0A556QJY2 | 3-145 | None |
| A0A7V9B9D9 | 1-161 | None |
| A0A512M8K4 | 1-150 | None |
| A6WGL1 | 28-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.