DPCstruct | MC10054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357NHV2 | 24-93 | MLVPPSPHLCQECAENHPPEFPHNLESIYYQTKFLMEHDRAATWADAIAHCPDDIKEFTISELRKLGIEV |
| W0AG23 | 1-72 | MFMMPAREGACETCATAHEPHLPHNAQSIFYSIRFQAEHGRAPTWIDAMAHCSDEMRALWTKALTDRGVDVA |
| A0A265Q7K3 | 1-67 | None |
| A0A2S3R2J6 | 3-65 | None |
| A0A358Q152 | 128-200 | None |
| A0A0C1VTA0 | 12-85 | None |
| A0A2T5UPX1 | 36-105 | None |
| A0A7C7A5D1 | 15-80 | None |
| A0A4V2L093 | 4-66 | None |
| A0A2V2D688 | 7-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.