DPCstruct | MC10051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 12.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6M6A5 | 160-267 | EEMSRTATRGAIERGRIMADTNREIADMQMRGWEERNAASDRMHDRSIDAITETTRYQDPAAGGQVRLDGYSDNAWRAADGSYIQSD… |
| A0A7V6B564 | 163-293 | ADYEPILMTILSSFQLNPNWLVAMNKAEQQRAQTRMRYQQEILEIQDRMLKHRAQTNEEISRSIGLELSNQAEFVDPRSGEVRTLSS… |
| A0A352Q790 | 1-81 | None |
| A0A1V8M2X3 | 157-269 | None |
| A0A540VBF5 | 838-947 | None |
| A0A090W8I8 | 2-108 | None |
| A0A7W1L670 | 474-580 | None |
| A0A7W1BEM4 | 168-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.