DPCstruct | MC1005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0ZGC6 | 6-101 | SLADFEPTRQTLHLYSQAVGVIPRVHGIAHPKWWHISLKLRPDGLTTDNIPLPGGGVLALRLDLHQHRLIVAGSSGETKSVSLADGL… |
| A0A7W8KWB3 | 1-101 | MNTTTHPWPKLDYHYLKDTLATVHMWTQMIGKVRLKKMPWINHSWQVTLYVSATGLTTGSIPYGGGVFQIDLDFIKHQLHITTSTGE… |
| A0A1G9NI57 | 2-82 | None |
| A0A840I796 | 19-97 | None |
| A0A561UUF3 | 1-92 | None |
| A0A7R7BHA8 | 2-91 | None |
| A7C646 | 1-103 | None |
| A0A536HXX0 | 10-95 | None |
| A0A6C1NMG9 | 7-99 | None |
| A0A537B357 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.