DPCstruct | MC10046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 227 ± 21 aa |
| Standard deviation of domain lengths | 21.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4U930 | 664-887 | KNLKWALSTMLMIIPTTIIFYFLFDGVLPHAIIIDEESKHIVVMTSLADFLGTMPPVVMTSKKHEYRYWTWENSCFWIAVIPQIAVL… |
| A0A2T7IKU8 | 1-263 | MTFFRTLSHAFSPLMMIFVSSLIKDFLFPNLLPYALLSKFRWNFVTVMSSILKLIGPVLLFSLESNSLFPKWDTPYNAFWIIVVPMA… |
| Q4N1Y7 | 1026-1242 | None |
| Q4N1S5 | 368-591 | None |
| Q4MYC4 | 445-670 | None |
| L1LC13 | 789-1024 | None |
| S6AZ02 | 2-227 | None |
| A0A2T7ISW2 | 118-333 | None |
| A0A2T7IQ65 | 1-231 | None |
| A0A2T7IG38 | 45-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.