DPCstruct | MC10045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.72 |
| Pfam Score | 77.65 |
| Assigned Pfam label(s) | CL0229- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507CFK6 | 88-212 | RDTVLQTQDDVPRSDVNNQVFVAKAEKALAGKPESLVDYGKADSAAKEALKRMARSEPYYKRNKPHLCSFYAKGECRRGDECPFRHE… |
| A0A183GYC5 | 79-214 | RDHALQIQDDLPRQGANRDYYIQNQERELALTDGTTPGGALAKISDSASNDLLKKLARNQPYYQRNKPHICSFFVKGECRRGEECPY… |
| A0A1R1X1W9 | 11-129 | None |
| A0A177AZ22 | 104-230 | None |
| A0A834ZL78 | 104-228 | None |
| A0A078BAH4 | 62-199 | None |
| A0A673JF18 | 85-211 | None |
| A0A368H6R4 | 643-778 | None |
| A0A427XHV8 | 94-229 | None |
| A0A5B0ML58 | 62-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.