DPCstruct | MC10043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 716 |
|---|---|
| Mean domain length (aa) | 166 ± 31 aa |
| Standard deviation of domain lengths | 31.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.02 |
| Pfam Score | 91.83 |
| Assigned Pfam label(s) | CL0349- CL0063- CL0221- CL0113- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2Y9L3 | 108-277 | REATNISRQVVVFWDIENCAVPSSVSGNYVVHKLLRRMKLFGDIISIRVYACMELLKTELKLALQTSGVELIDARRDNWVVQSRCYD… |
| U1NXQ3 | 3-99 | QRLYLDEHATPNLLRAAEERGFEVITTSGDVDVRLAVDATATAVENTIDVLVLVSRDADFKPALERAATRGVRTVAIAPGSYGRSDA… |
| M4D0Y5 | 1-152 | None |
| M4D5K9 | 230-418 | None |
| M4DE77 | 322-472 | None |
| A0A5B8MF83 | 142-299 | None |
| A0A1L9PM54 | 281-510 | None |
| A0A5C3MBS8 | 15-194 | None |
| A0A2P4ZBJ0 | 60-278 | None |
| A0A397SEC2 | 129-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.