DPCstruct | MC10042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0LDQ2 | 14-196 | ITANWSWYNKLMGIVSWNFKNNSAFQETAVLYRSGYFFGNAYFPIYLENGVSMWGTQLAPLTNRGIDRNTMPLGIVDFGQGNRIIAF… |
| M2Y6L7 | 20-209 | ALSNGTSTSYFCASSSSGVVVSYEWVEKDKGILSWVMNNTANTVSTFILVRGAIYQDTELIGPYAFGAAYYPAYIYNGLAQYFQGPP… |
| T0M1R7 | 1-193 | None |
| A0A2R6AF03 | 19-239 | None |
| A0A218ZT69 | 24-208 | None |
| A0A2J6NCZ7 | 3-228 | None |
| A0A7V5I355 | 168-371 | None |
| A0A1W6K315 | 21-234 | None |
| M2XQQ7 | 4-209 | None |
| A0A2J6NC22 | 5-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.