DPCstruct | MC10041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 258 ± 19 aa |
| Standard deviation of domain lengths | 18.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 84.52 |
| Assigned Pfam label(s) | PF19439- PF09758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J9TRY7 | 171-409 | EHINFLITYPFDFRIDEMLSYYISFLRAISGKLNKNTISLLVKTKNDDVISFPLYAEALKFAFHEDSMIRVAIRTLTLNVYHVGDES… |
| A0A078HMP2 | 277-534 | LLQTMSIMIQNLKSEQAIYYLFSNEYVNYLITYTFDFQHEELLSYYISFLRAVSGKLNQHTISLLLKTENDVVVSFPLYVEGIKFAF… |
| A0A6H5G832 | 126-341 | None |
| A0A6H5K930 | 99-376 | None |
| A0A6N2MVQ6 | 103-367 | None |
| A0A2R5GU26 | 150-425 | None |
| A0A226EV27 | 301-551 | None |
| A0A3P6DU94 | 294-561 | None |
| A0A674DXE8 | 97-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.