DPCstruct | MC10040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1A3E7 | 8-112 | GKVVRHNDGLVGTFLKLFRMDEFKWGNLVGEDKYGNKYFQNDYYFYGRNRWVEFPLSVGHDYDASQVPAEWHRWLQYIADEPPTQLP… |
| M2Y2Q1 | 11-136 | IRWRGLWGTFQAAKMNRLGTMKYFVGEDEFHNRYFQKVNDVMLKDRWVEYASKDFTPDPYSLPPEWHAWLHHSIDEPPTRTPFQRPI… |
| A0A433QC93 | 56-180 | None |
| A0A670IVR4 | 74-209 | None |
| A0A5C7NP16 | 95-220 | None |
| A0A170SFW2 | 3-81 | None |
| A0A4R0RCA3 | 284-412 | None |
| W2V3A2 | 3-96 | None |
| A0A0K6GDN2 | 13-133 | None |
| A0A7S4MY89 | 18-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.