DPCstruct | MC1004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4FI66 | 1-51 | MYKLKIAVLFGGCSEEHDVSVKSAMEVAANINKEKYQLFYIGITKSGAWKL |
| G9GCQ8 | 2-52 | TRRPKVAILFGGCSEEHHVSVKSAMEVAASIDTQKYAPIYIGITRSGVWKM |
| A0A850J4Q8 | 3-60 | None |
| A0A380EKK8 | 1-65 | None |
| A0A7W5WIN9 | 1-52 | None |
| A0A509CQD7 | 27-80 | None |
| A0A315QS02 | 3-53 | None |
| A0A0K2R417 | 14-68 | None |
| A0A7V1HDM5 | 120-177 | None |
| A0A447S0X5 | 12-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.