DPCstruct | MC10037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 238 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2XXH0 | 71-346 | KNEEILAQLDKKNKEALQLQEELAKVQEQLFEVQKMVENPHLSQWLRSKAEFLKTYVDPYLLEAIENTKNQLSSTNYLSTQVVDHLR… |
| A0A388MEA0 | 640-872 | NLMEPVQKTFSGLHKKTRESVFPKMGQAKDLGVKIFEQTHSSLNEGLTPLLGKNYSPIVSTLIAYGMLLVPLIITIFIVERVRAVLS… |
| K8EPR0 | 113-341 | None |
| A0A2R6X4U3 | 348-578 | None |
| A0A7S1TIR0 | 3-262 | None |
| A0A4S8J7Y2 | 200-438 | None |
| A0A396GP62 | 14-231 | None |
| C1MI00 | 2-199 | None |
| A0A812TUI9 | 7-302 | None |
| A9U0J4 | 956-1170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.