DPCstruct | MC10036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7QKD0 | 2-100 | FQVIEFYASGAAMEEYRPRSPQELGLHPRDVTLFAPISRLAAPQRATIAVHDGKILVKTEIVKAIITADKAVLIKGRRLKDTHKLSQ… |
| M2XKC1 | 5-156 | EMENEDEFMLKCLEILRDGRSSFRTINRKSVISEANQSVLWSGLSKRGRTNRKLNFTDLKVVDPAFRRGATLRLLSNVIILSVFDLR… |
| A0A6D2JGP3 | 18-142 | None |
| A0A099P4C4 | 235-391 | None |
| A0A811MQ38 | 77-241 | None |
| A0A7I4DPK2 | 31-178 | None |
| A0A445D5Z7 | 34-166 | None |
| A0A815HDF6 | 9-166 | None |
| A0A6J0NNK8 | 9-165 | None |
| A0A5B8MK74 | 167-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.